1.67 Rating by CuteStat

pixeljobs.in is 9 years 10 months old. It is a domain having in extension. It has a global traffic rank of #910102 in the world. This website is estimated worth of $ 720.00 and have a daily income of around $ 3.00. Furthermore the website is monetizing from Google Adsense. As no active threats were reported recently by users, pixeljobs.in is SAFE to browse.

PageSpeed Score
66
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: 529
Daily Pageviews: 1,058

Estimated Valuation

Income Per Day: $ 3.00
Estimated Worth: $ 720.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 910,102
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

23.229.194.8

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 18
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: 14 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 29
Google Adsense: pub-1686465965840521 Google Analytics: UA-52544011-1

Websites Hosted on Same IP (i.e. 23.229.194.8)

Coming Soon - Future home of something quite cool

- pitchtofund.com
Not Applicable $ 8.95

Coming Soon

- alnada-bdc.com
Not Applicable $ 8.95

ACS Roofing Company | (832) 593-0027

- acsroofingcompany.com

This is valuable website which provides the information about the ACS Roofing Company.

13,213,249 $ 8.95

Accent Builders DFW

- accentbuildersdfw.com

This is a valuable website which provides information about the Accent Builder DFW

Not Applicable $ 8.95

Lawn Sprinkler System in Cincinnati | Paramount Landscaping (513) 984-

- cincinnatilawnsprinklersystem.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Mon, 28 Jul 2014 23:29:01 GMT
Server: Apache mod_fcgid/2.3.10-dev
X-Powered-By: PHP/5.4.26
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, post-check=0, pre-check=0
Content-Language: en
X-UA-Compatible: IE=edge,chrome=1
X-Generator: Drupal 7 (http://drupal.org)
Link: <http://www.pixeljobs.in/>; rel="canonical",<http://www.pixeljobs.in/>; rel="shortlink"
Last-Modified: Mon, 28 Jul 2014 23:29:01 GMT
ETag: "1406590141"
Content-Length: 61391
Content-Type: text/html; charset=utf-8

Domain Information

Domain Registrar: Everest 43, LLC
Registration Date: Jun 5, 2014, 12:00 AM 9 years 10 months 2 weeks ago
Last Modified: Jun 5, 2014, 12:00 AM 9 years 10 months 2 weeks ago
Expiration Date: Jun 5, 2015, 12:00 AM 8 years 10 months 2 weeks ago
Domain Status:
CLIENT DELETE PROHIBITED
CLIENT RENEW PROHIBITED
CLIENT TRANSFER PROHIBITED
CLIENT UPDATE PROHIBITED
TRANSFER PROHIBITED
Owner's E-Mail: seena@thoughtgridinteractive.com

Domain Nameserver Information

Host IP Address Country
ns37.domaincontrol.com 97.74.108.19 United States of America United States of America
ns38.domaincontrol.com 173.201.76.19 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
pixeljobs.in A 552 IP: 23.229.194.8
pixeljobs.in NS 3599 Target: ns38.domaincontrol.com
pixeljobs.in NS 3599 Target: ns37.domaincontrol.com
pixeljobs.in SOA 86399 MNAME: ns37.domaincontrol.com
RNAME: dns.jomax.net
Serial: 2014071401
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
pixeljobs.in MX 3599 Target: smtp.asia.secureserver.net
pixeljobs.in MX 3599 Priority: 10
Target: mailstore1.asia.secureserver.net

Similarly Ranked Websites

Smadav Download Server (UNJUK.COM)

- unjuk.com
910,103 $ 1,440.00

AfroMarket Zimbabwe | Buy, Sell, Trade Locally On Your Mobile In Zimba

- zim.afromarket.com

Zimbabweans Buy, Sell and Trade New and Used Items on AfroMarket

910,112 $ 720.00


About | www.OracleAppsQuery.com

- oracleappsquery.com
910,113 $ 720.00

Festival Vaivén 2020

- festivalvaiven.com

Conoce los detalles del Festival Vaivén 2020, cuya realización se dará el próximo 28 de marzo en Jardines de México, Morelos.

910,114 $ 1,440.00

Full WHOIS Lookup

Access to .IN WHOIS information is provided to assist persons in
determining the contents of a domain name registration record in the
.IN registry database. The data in this record is provided by
.IN Registry for informational purposes only, and .IN does not
guarantee its accuracy. This service is intended only for query-based
access. You agree that you will use this data only for lawful purposes
and that, under no circumstances will you use this data to: (a) allow,
enable, or otherwise support the transmission by e-mail, telephone, or
facsimile of mass unsolicited, commercial advertising or solicitations
to entities other than the data recipient's own existing customers; or
(b) enable high volume, automated, electronic processes that send
queries or data to the systems of Registry Operator, a Registrar, or
Afilias except as reasonably necessary to register domain names or
modify existing registrations. All rights reserved. .IN reserves
the right to modify these terms at any time. By submitting this query,
you agree to abide by this policy.

Domain ID:D8464354-AFIN
Domain Name:PIXELJOBS.IN
Created On:05-Jun-2014 05:31:30 UTC
Last Updated On:05-Jun-2014 05:31:31 UTC
Expiration Date:05-Jun-2015 05:31:30 UTC
Sponsoring Registrar:GoDaddy.com, LLC (R101-AFIN)
Status:CLIENT DELETE PROHIBITED
Status:CLIENT RENEW PROHIBITED
Status:CLIENT TRANSFER PROHIBITED
Status:CLIENT UPDATE PROHIBITED
Status:TRANSFER PROHIBITED
Registrant ID:CR169885257
Registrant Name:Ajith K
Registrant Organization:Thoughtgrid Interactive
Registrant Street1:Abode Across
Registrant Street2:HSR Layout
Registrant Street3:
Registrant City:Bangalore
Registrant State/Province:Karnataka
Registrant Postal Code:560068
Registrant Country:IN
Registrant Phone:+91.8497011981
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Email:seena@thoughtgridinteractive.com
Admin ID:CR169885259
Admin Name:Ajith K
Admin Organization:Thoughtgrid Interactive
Admin Street1:Abode Across
Admin Street2:HSR Layout
Admin Street3:
Admin City:Bangalore
Admin State/Province:Karnataka
Admin Postal Code:560068
Admin Country:IN
Admin Phone:+91.8497011981
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Email:seena@thoughtgridinteractive.com
Tech ID:CR169885258
Tech Name:Ajith K
Tech Organization:Thoughtgrid Interactive
Tech Street1:Abode Across
Tech Street2:HSR Layout
Tech Street3:
Tech City:Bangalore
Tech State/Province:Karnataka
Tech Postal Code:560068
Tech Country:IN
Tech Phone:+91.8497011981
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Email:seena@thoughtgridinteractive.com
Name Server:NS37.DOMAINCONTROL.COM
Name Server:NS38.DOMAINCONTROL.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned